PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009795437.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 259aa    MW: 28742.2 Da    PI: 4.3258
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009795437.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS90.13.6e-281312481126
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv+ L++c eav+ ++l+la+al+  ++e+a ++ +p++++a+yf+eAL +++++   +l ++++    +     ++l+    ++ev P+l+f++
  XP_009795437.1 131 LVKILMACGEAVQRNNLNLADALVRLIREHAVSQFRPIKKVATYFAEALDQKIQG--MNLEDIMEFCCYT-----DNLMQ-MRLHEVRPYLEFAY 217
                     6789***************************************************..4444444444443.....33333.3489********** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWp 126
                        N+aIl+a+++++rvHiiDf+++qG QW+
  XP_009795437.1 218 SSVNRAILDAFANSSRVHIIDFSLNQGPQWL 248
                     ******************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098518.321105259IPR005202Transcription factor GRAS
PfamPF035141.2E-25131248IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MSMDTIMENS DSFVSTTDAI IHGASNISGW TQSLISDPNI PNSSTSVDDH LQQISTAGNG  60
DDMIVSCATS RIFNSIDVSA FSRNINAVCD NYSDKLAEEG SESSNEMRSR DGLELCLGLS  120
IGSGAVNEEL LVKILMACGE AVQRNNLNLA DALVRLIREH AVSQFRPIKK VATYFAEALD  180
QKIQGMNLED IMEFCCYTDN LMQMRLHEVR PYLEFAYSSV NRAILDAFAN SSRVHIIDFS  240
LNQGPQWLFG SLEYNWLTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795437.10.0PREDICTED: DELLA protein GAI-like
TrEMBLK4D4701e-57K4D470_SOLLC; Uncharacterized protein
STRINGSolyc10g086380.1.13e-57(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2381522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.18e-32GRAS family protein